Lineage for d1ehhb1 (1ehh B:1-45)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 268805Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 268806Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) (S)
  5. 268807Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (3 proteins)
  6. 268811Protein Isolectin VI [57020] (1 species)
    consists of two homologous domains
  7. 268812Species Stinging nettle (Urtica dioica), UDA [TaxId:3501] [57021] (6 PDB entries)
  8. 268821Domain d1ehhb1: 1ehh B:1-45 [44056]

Details for d1ehhb1

PDB Entry: 1ehh (more details), 1.9 Å

PDB Description: crystal structure of urtica dioica agglutinin isolectin vi complex with tri-n-acetylchitotriose

SCOP Domain Sequences for d1ehhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehhb1 g.3.1.1 (B:1-45) Isolectin VI {Stinging nettle (Urtica dioica), UDA}
ercgsqgggatcpglrccsiwgwcgdsepycgrtcenkcwsgers

SCOP Domain Coordinates for d1ehhb1:

Click to download the PDB-style file with coordinates for d1ehhb1.
(The format of our PDB-style files is described here.)

Timeline for d1ehhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ehhb2