![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) ![]() |
![]() | Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins) |
![]() | Protein Isolectin VI [57020] (1 species) consists of two homologous domains |
![]() | Species Stinging nettle (Urtica dioica), UDA [TaxId:3501] [57021] (6 PDB entries) |
![]() | Domain d1ehhb1: 1ehh B:1-45 [44056] |
PDB Entry: 1ehh (more details), 1.9 Å
SCOPe Domain Sequences for d1ehhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehhb1 g.3.1.1 (B:1-45) Isolectin VI {Stinging nettle (Urtica dioica), UDA [TaxId: 3501]} ercgsqgggatcpglrccsiwgwcgdsepycgrtcenkcwsgers
Timeline for d1ehhb1: