Lineage for d1ehha2 (1ehh A:46-89)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 888905Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) (S)
  5. 888906Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (6 proteins)
  6. 888916Protein Isolectin VI [57020] (1 species)
    consists of two homologous domains
  7. 888917Species Stinging nettle (Urtica dioica), UDA [TaxId:3501] [57021] (6 PDB entries)
  8. 888927Domain d1ehha2: 1ehh A:46-89 [44055]

Details for d1ehha2

PDB Entry: 1ehh (more details), 1.9 Å

PDB Description: crystal structure of urtica dioica agglutinin isolectin vi complex with tri-n-acetylchitotriose
PDB Compounds: (A:) agglutinin isolectin vi

SCOP Domain Sequences for d1ehha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehha2 g.3.1.1 (A:46-89) Isolectin VI {Stinging nettle (Urtica dioica), UDA [TaxId: 3501]}
dhrcgaavgnppcgqdrccsvhgwcgggndycsggkcqyrcsss

SCOP Domain Coordinates for d1ehha2:

Click to download the PDB-style file with coordinates for d1ehha2.
(The format of our PDB-style files is described here.)

Timeline for d1ehha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ehha1