SCOP 1.73: Domain d1ehha2: 1ehh A:46-89

Lineage for d1ehha2 (1ehh A:46-89)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families)

5. Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (6 proteins)

6. Protein Isolectin VI [57020] (1 species)
   consists of two homologous domains

7. Species Stinging nettle (Urtica dioica), UDA [TaxId:3501] [57021] (6 PDB entries)

8. Domain d1ehha2: 1ehh A:46-89 [44055]

Details for d1ehha2

PDB Entry: 1ehh, 1.9 Å

PDB Description: crystal structure of urtica dioica agglutinin isolectin vi complex with tri-n-acetylchitotriose

PDB Compounds: (A:) agglutinin isolectin vi

SCOP Domain Sequences for d1ehha2:

Sequence; same for both SEQRES and ATOM records:

>d1ehha2 g.3.1.1 (A:46-89) Isolectin VI {Stinging nettle (Urtica dioica), UDA [TaxId: 3501]}
dhrcgaavgnppcgqdrccsvhgwcgggndycsggkcqyrcsss

Timeline for d1ehha2:

• d1ehha2 first appeared (with stable ids) in SCOP 1.55
  
• d1ehha2 appears in SCOP 1.71
  
• d1ehha2 appears in SCOP 1.75
  
• d1ehha2 appears in the current release, SCOPe 2.08