Lineage for d1ehha1 (1ehh A:1-45)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 621450Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 621451Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) (S)
  5. 621452Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (6 proteins)
  6. 621462Protein Isolectin VI [57020] (1 species)
    consists of two homologous domains
  7. 621463Species Stinging nettle (Urtica dioica), UDA [TaxId:3501] [57021] (6 PDB entries)
  8. 621470Domain d1ehha1: 1ehh A:1-45 [44054]

Details for d1ehha1

PDB Entry: 1ehh (more details), 1.9 Å

PDB Description: crystal structure of urtica dioica agglutinin isolectin vi complex with tri-n-acetylchitotriose

SCOP Domain Sequences for d1ehha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehha1 g.3.1.1 (A:1-45) Isolectin VI {Stinging nettle (Urtica dioica), UDA}
ercgsqgggatcpglrccsiwgwcgdsepycgrtcenkcwsgers

SCOP Domain Coordinates for d1ehha1:

Click to download the PDB-style file with coordinates for d1ehha1.
(The format of our PDB-style files is described here.)

Timeline for d1ehha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ehha2