Lineage for d1ehda2 (1ehd A:46-89)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 427258Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 427259Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) (S)
  5. 427260Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (5 proteins)
  6. 427265Protein Isolectin VI [57020] (1 species)
    consists of two homologous domains
  7. 427266Species Stinging nettle (Urtica dioica), UDA [TaxId:3501] [57021] (6 PDB entries)
  8. 427270Domain d1ehda2: 1ehd A:46-89 [44051]

Details for d1ehda2

PDB Entry: 1ehd (more details), 1.5 Å

PDB Description: crystal structure of urtica dioica agglutinin isolectin vi

SCOP Domain Sequences for d1ehda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehda2 g.3.1.1 (A:46-89) Isolectin VI {Stinging nettle (Urtica dioica), UDA}
dhrcgaavgnppcgqdrccsvhgwcgggndycsggkcqyrcsss

SCOP Domain Coordinates for d1ehda2:

Click to download the PDB-style file with coordinates for d1ehda2.
(The format of our PDB-style files is described here.)

Timeline for d1ehda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ehda1