Lineage for d1ehda2 (1ehd A:46-89)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3029894Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) (S)
  5. 3029895Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins)
  6. 3029906Protein Isolectin VI [57020] (1 species)
    consists of two homologous domains
  7. 3029907Species Stinging nettle (Urtica dioica), UDA [TaxId:3501] [57021] (6 PDB entries)
  8. 3029911Domain d1ehda2: 1ehd A:46-89 [44051]

Details for d1ehda2

PDB Entry: 1ehd (more details), 1.5 Å

PDB Description: crystal structure of urtica dioica agglutinin isolectin vi
PDB Compounds: (A:) agglutinin isolectin vi

SCOPe Domain Sequences for d1ehda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehda2 g.3.1.1 (A:46-89) Isolectin VI {Stinging nettle (Urtica dioica), UDA [TaxId: 3501]}
dhrcgaavgnppcgqdrccsvhgwcgggndycsggkcqyrcsss

SCOPe Domain Coordinates for d1ehda2:

Click to download the PDB-style file with coordinates for d1ehda2.
(The format of our PDB-style files is described here.)

Timeline for d1ehda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ehda1