Lineage for d1en2a2 (1en2 A:46-86)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 427258Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 427259Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) (S)
  5. 427260Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (5 proteins)
  6. 427265Protein Isolectin VI [57020] (1 species)
    consists of two homologous domains
  7. 427266Species Stinging nettle (Urtica dioica), UDA [TaxId:3501] [57021] (6 PDB entries)
  8. 427268Domain d1en2a2: 1en2 A:46-86 [44049]
    complexed with nag

Details for d1en2a2

PDB Entry: 1en2 (more details), 1.4 Å

PDB Description: uda tetrasaccharide complex. crystal structure of urtica dioica agglutinin, a superantigen presented by mhc molecules of class i and class ii

SCOP Domain Sequences for d1en2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1en2a2 g.3.1.1 (A:46-86) Isolectin VI {Stinging nettle (Urtica dioica), UDA}
dhrcgaavgnppcgqdrccsvhgwcgggndycsgskcqyrc

SCOP Domain Coordinates for d1en2a2:

Click to download the PDB-style file with coordinates for d1en2a2.
(The format of our PDB-style files is described here.)

Timeline for d1en2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1en2a1