Lineage for d1en2a1 (1en2 A:1-45)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 341571Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 341572Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) (S)
  5. 341573Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (3 proteins)
  6. 341577Protein Isolectin VI [57020] (1 species)
    consists of two homologous domains
  7. 341578Species Stinging nettle (Urtica dioica), UDA [TaxId:3501] [57021] (6 PDB entries)
  8. 341579Domain d1en2a1: 1en2 A:1-45 [44048]

Details for d1en2a1

PDB Entry: 1en2 (more details), 1.4 Å

PDB Description: uda tetrasaccharide complex. crystal structure of urtica dioica agglutinin, a superantigen presented by mhc molecules of class i and class ii

SCOP Domain Sequences for d1en2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1en2a1 g.3.1.1 (A:1-45) Isolectin VI {Stinging nettle (Urtica dioica), UDA}
ercgsqggggtcpalwccsiwgwcgdsepycgrtcenkcwsgers

SCOP Domain Coordinates for d1en2a1:

Click to download the PDB-style file with coordinates for d1en2a1.
(The format of our PDB-style files is described here.)

Timeline for d1en2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1en2a2