Lineage for d1wgcb4 (1wgc B:130-171)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2581532Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) (S)
  5. 2581533Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins)
  6. 2581580Protein Wheat germ agglutinin (WGA) [57018] (1 species)
    one subunit consists of four homologous domains
  7. 2581581Species Wheat (Triticum aestivum), also known as Triticum vulgare [TaxId:4565] [57019] (13 PDB entries)
  8. 2581677Domain d1wgcb4: 1wgc B:130-171 [44047]
    complexed with bgc, gal, sia

Details for d1wgcb4

PDB Entry: 1wgc (more details), 2.2 Å

PDB Description: 2.2 angstroms resolution structure analysis of two refined n- acetylneuraminyllactose-wheat germ agglutinin isolectin complexes
PDB Compounds: (B:) wheat germ lectin

SCOPe Domain Sequences for d1wgcb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgcb4 g.3.1.1 (B:130-171) Wheat germ agglutinin (WGA) {Wheat (Triticum aestivum), also known as Triticum vulgare [TaxId: 4565]}
kpcgkdaggrvctnnyccskwgscgigpgycgagcqsggcdg

SCOPe Domain Coordinates for d1wgcb4:

Click to download the PDB-style file with coordinates for d1wgcb4.
(The format of our PDB-style files is described here.)

Timeline for d1wgcb4: