Lineage for d1wgcb1 (1wgc B:1-52)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2634701Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) (S)
  5. 2634702Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins)
  6. 2634749Protein Wheat germ agglutinin (WGA) [57018] (1 species)
    one subunit consists of four homologous domains
  7. 2634750Species Wheat (Triticum aestivum), also known as Triticum vulgare [TaxId:4565] [57019] (13 PDB entries)
  8. 2634843Domain d1wgcb1: 1wgc B:1-52 [44044]
    complexed with bgc, gal, sia

Details for d1wgcb1

PDB Entry: 1wgc (more details), 2.2 Å

PDB Description: 2.2 angstroms resolution structure analysis of two refined n- acetylneuraminyllactose-wheat germ agglutinin isolectin complexes
PDB Compounds: (B:) wheat germ lectin

SCOPe Domain Sequences for d1wgcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgcb1 g.3.1.1 (B:1-52) Wheat germ agglutinin (WGA) {Wheat (Triticum aestivum), also known as Triticum vulgare [TaxId: 4565]}
ercgeqgsnmecpnnlccsqygycgmggdycgkgcqngacwtskrcgsqagg

SCOPe Domain Coordinates for d1wgcb1:

Click to download the PDB-style file with coordinates for d1wgcb1.
(The format of our PDB-style files is described here.)

Timeline for d1wgcb1: