Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) |
Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins) |
Protein Wheat germ agglutinin (WGA) [57018] (1 species) one subunit consists of four homologous domains |
Species Wheat (Triticum aestivum), also known as Triticum vulgare [TaxId:4565] [57019] (13 PDB entries) |
Domain d1wgcb1: 1wgc B:1-52 [44044] complexed with bgc, gal, sia |
PDB Entry: 1wgc (more details), 2.2 Å
SCOPe Domain Sequences for d1wgcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgcb1 g.3.1.1 (B:1-52) Wheat germ agglutinin (WGA) {Wheat (Triticum aestivum), also known as Triticum vulgare [TaxId: 4565]} ercgeqgsnmecpnnlccsqygycgmggdycgkgcqngacwtskrcgsqagg
Timeline for d1wgcb1:
View in 3D Domains from other chains: (mouse over for more information) d1wgca1, d1wgca2, d1wgca3, d1wgca4 |