Lineage for d1wgca4 (1wgc A:130-171)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies) 
Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) 
Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (3 proteins) 
Protein Wheat germ agglutinin (WGA) [57018] (1 species) Species Wheat (Triticum vulgaris) [57019] (6 PDB entries) 
Domain d1wgca4: 1wgc A:130-171 [44043]
Details for d1wgca4
PDB Entry: 1wgc (more details), 2.2 Å
PDB Description: 2.2 angstroms resolution structure analysis of two refined n- acetylneuraminyllactose-wheat germ agglutinin isolectin complexes
SCOP Domain Sequences for d1wgca4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgca4 g.3.1.1 (A:130-171) Wheat germ agglutinin (WGA) {Wheat (Triticum vulgaris)}
kpcgkdaggrvctnnyccskwgscgigpgycgagcqsggcdg
SCOP Domain Coordinates for d1wgca4:
Click to download the PDB-style file with coordinates for d1wgca4.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wgca4:
- d1wgca4 appears in SCOP 1.57
- d1wgca4 appears in the current release, SCOPe 2.08
 View in 3DDomains from other chains: (mouse over for more information) d1wgcb1, d1wgcb2, d1wgcb3, d1wgcb4 |
