Lineage for d1wgca1 (1wgc A:1-52)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39580Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) (S)
  5. 39581Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (3 proteins)
  6. 39599Protein Wheat germ agglutinin (WGA) [57018] (1 species)
  7. 39600Species Wheat (Triticum vulgaris) [57019] (6 PDB entries)
  8. 39641Domain d1wgca1: 1wgc A:1-52 [44040]

Details for d1wgca1

PDB Entry: 1wgc (more details), 2.2 Å

PDB Description: 2.2 angstroms resolution structure analysis of two refined n- acetylneuraminyllactose-wheat germ agglutinin isolectin complexes

SCOP Domain Sequences for d1wgca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgca1 g.3.1.1 (A:1-52) Wheat germ agglutinin (WGA) {Wheat (Triticum vulgaris)}
ercgeqgsnmecpnnlccsqygycgmggdycgkgcqngacwtskrcgsqagg

SCOP Domain Coordinates for d1wgca1:

Click to download the PDB-style file with coordinates for d1wgca1.
(The format of our PDB-style files is described here.)

Timeline for d1wgca1: