Lineage for d1wgca1 (1wgc A:1-52)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) (S)
  5. Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins)
  6. Protein Wheat germ agglutinin (WGA) [57018] (1 species)
    one subunit consists of four homologous domains
  7. Species Wheat (Triticum aestivum), also known as Triticum vulgare [TaxId:4565] [57019] (13 PDB entries)
  8. Domain d1wgca1: 1wgc A:1-52 [44040]

Details for d1wgca1

PDB Entry: 1wgc (more details), 2.2 Å

PDB Description: 2.2 angstroms resolution structure analysis of two refined n- acetylneuraminyllactose-wheat germ agglutinin isolectin complexes
PDB Compounds: (A:) wheat germ lectin

SCOPe Domain Sequences for d1wgca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgca1 g.3.1.1 (A:1-52) Wheat germ agglutinin (WGA) {Wheat (Triticum aestivum), also known as Triticum vulgare [TaxId: 4565]}
ercgeqgsnmecpnnlccsqygycgmggdycgkgcqngacwtskrcgsqagg

SCOPe Domain Coordinates for d1wgca1 are not available.

Timeline for d1wgca1:

Domains from same chain:
(mouse over for more information)
d1wgca2, d1wgca3, d1wgca4
Domains from other chains:
(mouse over for more information)
d1wgcb1, d1wgcb2, d1wgcb3, d1wgcb4