Lineage for d2wgca1 (2wgc A:1-52)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3029894Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) (S)
  5. 3029895Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins)
  6. 3029942Protein Wheat germ agglutinin (WGA) [57018] (1 species)
    one subunit consists of four homologous domains
  7. 3029943Species Wheat (Triticum aestivum), also known as Triticum vulgare [TaxId:4565] [57019] (13 PDB entries)
  8. 3030008Domain d2wgca1: 2wgc A:1-52 [44032]

Details for d2wgca1

PDB Entry: 2wgc (more details), 2.2 Å

PDB Description: 2.2 angstroms resolution structure analysis of two refined n- acetylneuraminyllactose-wheat germ agglutinin isolectin complexes
PDB Compounds: (A:) wheat germ lectin

SCOPe Domain Sequences for d2wgca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wgca1 g.3.1.1 (A:1-52) Wheat germ agglutinin (WGA) {Wheat (Triticum aestivum), also known as Triticum vulgare [TaxId: 4565]}
ercgeqgsnmecpnnlccsqygycgmggdycgkgcqngacwtskrcgsqagg

SCOPe Domain Coordinates for d2wgca1:

Click to download the PDB-style file with coordinates for d2wgca1.
(The format of our PDB-style files is described here.)

Timeline for d2wgca1: