Lineage for d1viba_ (1vib A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.2: Toxic hairpin [57006] (4 superfamilies)
    disulfide crosslinked alpha-helical hairpin
  4. Superfamily g.2.2: Neurotoxin B-IV [57011] (1 family) (S)
  5. Family g.2.2.1: Neurotoxin B-IV [57012] (1 protein)
    contains 4 disulfides
  6. Protein Neurotoxin B-IV [57013] (1 species)
  7. Species Milky ribbon worm (Cerebratulus lacteus) [TaxId:6221] [57014] (1 PDB entry)
  8. Domain d1viba_: 1vib A: [43999]

Details for d1viba_

PDB Entry: 1vib (more details)

PDB Description: nmr solution structure of the neurotoxin b-iv, 20 structures
PDB Compounds: (A:) neurotoxin b-IV

SCOPe Domain Sequences for d1viba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1viba_ g.2.2.1 (A:) Neurotoxin B-IV {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]}
asatwgaaypacenncrkkydlcircqgkwagkrgkcaahciiqknnckgkckke

SCOPe Domain Coordinates for d1viba_ are not available.

Timeline for d1viba_: