Lineage for d1ehsa_ (1ehs A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029872Fold g.2: Toxic hairpin [57006] (4 superfamilies)
    disulfide crosslinked alpha-helical hairpin
  4. 3029873Superfamily g.2.1: Heat-stable enterotoxin B [57007] (1 family) (S)
    automatically mapped to Pfam PF09075
  5. 3029874Family g.2.1.1: Heat-stable enterotoxin B [57008] (1 protein)
    contains 2 disulfides
  6. 3029875Protein Heat-stable enterotoxin B [57009] (1 species)
  7. 3029876Species Escherichia coli [TaxId:562] [57010] (1 PDB entry)
  8. 3029877Domain d1ehsa_: 1ehs A: [43998]

Details for d1ehsa_

PDB Entry: 1ehs (more details)

PDB Description: the structure of escherichia coli heat-stable enterotoxin b by nuclear magnetic resonance and circular dichroism
PDB Compounds: (A:) heat-stable enterotoxin b

SCOPe Domain Sequences for d1ehsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehsa_ g.2.1.1 (A:) Heat-stable enterotoxin B {Escherichia coli [TaxId: 562]}
stqsnkkdlcehyrqiakesckkgflgvrdgtagacfgaqimvaakgc

SCOPe Domain Coordinates for d1ehsa_:

Click to download the PDB-style file with coordinates for d1ehsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ehsa_: