Lineage for d1bqta_ (1bqt A:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 746752Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 746753Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 746754Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 746974Protein Insulin-like growth factor [57002] (1 species)
  7. 746975Species Human (Homo sapiens) [TaxId:9606] [57003] (18 PDB entries)
  8. 746988Domain d1bqta_: 1bqt A: [43994]

Details for d1bqta_

PDB Entry: 1bqt (more details)

PDB Description: three-dimensional structure of human insulin-like growth factor-i (igf-i) determined by 1h-nmr and distance geometry, 6 structures
PDB Compounds: (A:) insulin-like growth factor-I

SCOP Domain Sequences for d1bqta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqta_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
caplkpaksa

SCOP Domain Coordinates for d1bqta_:

Click to download the PDB-style file with coordinates for d1bqta_.
(The format of our PDB-style files is described here.)

Timeline for d1bqta_: