Lineage for d1bqt__ (1bqt -)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 621191Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 621192Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 621193Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 621413Protein Insulin-like growth factor [57002] (1 species)
  7. 621414Species Human (Homo sapiens) [TaxId:9606] [57003] (14 PDB entries)
  8. 621422Domain d1bqt__: 1bqt - [43994]

Details for d1bqt__

PDB Entry: 1bqt (more details)

PDB Description: three-dimensional structure of human insulin-like growth factor-i (igf-i) determined by 1h-nmr and distance geometry, 6 structures

SCOP Domain Sequences for d1bqt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqt__ g.1.1.1 (-) Insulin-like growth factor {Human (Homo sapiens)}
gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
caplkpaksa

SCOP Domain Coordinates for d1bqt__:

Click to download the PDB-style file with coordinates for d1bqt__.
(The format of our PDB-style files is described here.)

Timeline for d1bqt__: