SCOP 1.55: Domain d1bqt__: 1bqt -

Lineage for d1bqt__ (1bqt -)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (4 proteins)

6. Protein Insulin-like growth factor [57002] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57003] (6 PDB entries)

8. Domain d1bqt__: 1bqt - [43994]

Details for d1bqt__

PDB Entry: 1bqt

PDB Description: three-dimensional structure of human insulin-like growth factor-i (igf-i) determined by 1h-nmr and distance geometry, 6 structures

SCOP Domain Sequences for d1bqt__:

Sequence; same for both SEQRES and ATOM records:

>d1bqt__ g.1.1.1 (-) Insulin-like growth factor {Human (Homo sapiens)}
gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
caplkpaksa

Timeline for d1bqt__:

• d1bqt__ appears in SCOP 1.57
  
• d1bqt__ appears in the current release, SCOPe 2.08, called d1bqta_