SCOPe 2.08: Domain d1bqta_: 1bqt A:

Lineage for d1bqta_ (1bqt A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)
   nearly all-alpha
   can be classified as disulfide-rich

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (5 proteins)

6. Protein Insulin-like growth factor [57002] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
   Uniprot P05019 49-110

8. Domain d1bqta_: 1bqt A: [43994]

Details for d1bqta_

PDB Entry: 1bqt

PDB Description: three-dimensional structure of human insulin-like growth factor-i (igf-i) determined by 1h-nmr and distance geometry, 6 structures

PDB Compounds: (A:) insulin-like growth factor-I

SCOPe Domain Sequences for d1bqta_:

Sequence; same for both SEQRES and ATOM records:

>d1bqta_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
caplkpaksa

Timeline for d1bqta_:

• d1bqta_ first appeared (with stable ids) in SCOP 1.55, called d1bqt__
  
• d1bqta_ appears in SCOPe 2.07