SCOPe 2.07: Domain d2gf1a_: 2gf1 A:

Lineage for d2gf1a_ (2gf1 A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)
   nearly all-alpha
   can be classified as disulfide-rich

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (5 proteins)

6. Protein Insulin-like growth factor [57002] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
   Uniprot P05019 49-110

8. Domain d2gf1a_: 2gf1 A: [43990]

Details for d2gf1a_

PDB Entry: 2gf1

PDB Description: solution structure of human insulin-like growth factor 1: a nuclear magnetic resonance and restrained molecular dynamics study

PDB Compounds: (A:) insulin-like growth factor I

SCOPe Domain Sequences for d2gf1a_:

Sequence; same for both SEQRES and ATOM records:

>d2gf1a_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
caplkpaksa

Timeline for d2gf1a_:

• d2gf1a_ first appeared (with stable ids) in SCOP 1.55, called d2gf1__
  
• d2gf1a_ appears in SCOPe 2.06
  
• d2gf1a_ appears in the current release, SCOPe 2.08