![]() | Class g: Small proteins [56992] (61 folds) |
![]() | Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulphide-rich |
![]() | Superfamily g.1.1: Insulin-like [56994] (1 family) ![]() |
![]() | Family g.1.1.1: Insulin-like [56995] (4 proteins) |
![]() | Protein Insulin [56996] (3 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [56999] (16 PDB entries) |
![]() | Domain d1wav.6: 1wav L:,K: [43987] complexed with iph, zn |
PDB Entry: 1wav (more details), 2.5 Å
SCOP Domain Sequences for d1wav.6:
Sequence; same for both SEQRES and ATOM records: (download)
>g1wav.6 g.1.1.1 (L:,K:) Insulin {Pig (Sus scrofa)} fvnqhlcgshlvealylvcgergffytpkaXgiveqcctsicslyqlenycn
Timeline for d1wav.6: