Lineage for d1wav.6 (1wav L:,K:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 142454Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 142455Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 142456Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 142461Protein Insulin [56996] (3 species)
  7. 142607Species Pig (Sus scrofa) [TaxId:9823] [56999] (15 PDB entries)
  8. 142644Domain d1wav.6: 1wav L:,K: [43987]

Details for d1wav.6

PDB Entry: 1wav (more details), 2.5 Å

PDB Description: crystal structure of form b monoclinic crystal of insulin

SCOP Domain Sequences for d1wav.6:

Sequence; same for both SEQRES and ATOM records: (download)

>g1wav.6 g.1.1.1 (L:,K:) Insulin {Pig (Sus scrofa)}
fvnqhlcgshlvealylvcgergffytpkaXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d1wav.6:

Click to download the PDB-style file with coordinates for d1wav.6.
(The format of our PDB-style files is described here.)

Timeline for d1wav.6: