Lineage for d1wav.4 (1wav H:,G:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029609Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 3029610Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 3029611Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 3029616Protein Insulin [56996] (3 species)
  7. 3029784Species Pig (Sus scrofa) [TaxId:9823] [56999] (26 PDB entries)
  8. 3029831Domain d1wav.4: 1wav H:,G: [43985]
    complexed with iph, zn

Details for d1wav.4

PDB Entry: 1wav (more details), 2.5 Å

PDB Description: crystal structure of form b monoclinic crystal of insulin
PDB Compounds: (G:) insulin, (H:) insulin

SCOPe Domain Sequences for d1wav.4:

Sequence; same for both SEQRES and ATOM records: (download)

>g1wav.4 g.1.1.1 (H:,G:) Insulin {Pig (Sus scrofa) [TaxId: 9823]}
fvnqhlcgshlvealylvcgergffytpkaXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1wav.4:

Click to download the PDB-style file with coordinates for d1wav.4.
(The format of our PDB-style files is described here.)

Timeline for d1wav.4: