Lineage for d1wav.2 (1wav D:,C:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 142454Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 142455Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 142456Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 142461Protein Insulin [56996] (3 species)
  7. 142607Species Pig (Sus scrofa) [TaxId:9823] [56999] (15 PDB entries)
  8. 142640Domain d1wav.2: 1wav D:,C: [43983]

Details for d1wav.2

PDB Entry: 1wav (more details), 2.5 Å

PDB Description: crystal structure of form b monoclinic crystal of insulin

SCOP Domain Sequences for d1wav.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1wav.2 g.1.1.1 (D:,C:) Insulin {Pig (Sus scrofa)}
fvnqhlcgshlvealylvcgergffytpkaXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d1wav.2:

Click to download the PDB-style file with coordinates for d1wav.2.
(The format of our PDB-style files is described here.)

Timeline for d1wav.2: