Lineage for d1wav.1 (1wav B:,A:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 268578Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulphide-rich
  4. 268579Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 268580Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 268585Protein Insulin [56996] (3 species)
  7. 268736Species Pig (Sus scrofa) [TaxId:9823] [56999] (16 PDB entries)
  8. 268770Domain d1wav.1: 1wav B:,A: [43982]

Details for d1wav.1

PDB Entry: 1wav (more details), 2.5 Å

PDB Description: crystal structure of form b monoclinic crystal of insulin

SCOP Domain Sequences for d1wav.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1wav.1 g.1.1.1 (B:,A:) Insulin {Pig (Sus scrofa)}
fvnqhlcgshlvealylvcgergffytpkaXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d1wav.1:

Click to download the PDB-style file with coordinates for d1wav.1.
(The format of our PDB-style files is described here.)

Timeline for d1wav.1: