Lineage for d7ins.3 (7ins F:,E:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88228Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 88229Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 88230Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 88235Protein Insulin [56996] (3 species)
  7. 88378Species Pig (Sus scrofa) [TaxId:9823] [56999] (15 PDB entries)
  8. 88405Domain d7ins.3: 7ins F:,E: [43977]

Details for d7ins.3

PDB Entry: 7ins (more details), 2 Å

PDB Description: structure of porcine insulin cocrystallized with clupeine z

SCOP Domain Sequences for d7ins.3:

Sequence; same for both SEQRES and ATOM records: (download)

>g7ins.3 g.1.1.1 (F:,E:) Insulin {Pig (Sus scrofa)}
fvnqhlcgshlvealylvcgergffytpkaXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d7ins.3:

Click to download the PDB-style file with coordinates for d7ins.3.
(The format of our PDB-style files is described here.)

Timeline for d7ins.3: