Lineage for d7ins.2 (7ins D:,C:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634416Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 2634417Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 2634418Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 2634423Protein Insulin [56996] (3 species)
  7. 2634591Species Pig (Sus scrofa) [TaxId:9823] [56999] (26 PDB entries)
  8. 2634629Domain d7ins.2: 7ins D:,C: [43976]
    complexed with crs, unk, zn

Details for d7ins.2

PDB Entry: 7ins (more details), 2 Å

PDB Description: structure of porcine insulin cocrystallized with clupeine z
PDB Compounds: (C:) insulin (chain a), (D:) insulin (chain b)

SCOPe Domain Sequences for d7ins.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g7ins.2 g.1.1.1 (D:,C:) Insulin {Pig (Sus scrofa) [TaxId: 9823]}
fvnqhlcgshlvealylvcgergffytpkaXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d7ins.2:

Click to download the PDB-style file with coordinates for d7ins.2.
(The format of our PDB-style files is described here.)

Timeline for d7ins.2: