Lineage for d7ins.2 (7ins D:,C:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 268578Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulphide-rich
  4. 268579Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 268580Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 268585Protein Insulin [56996] (3 species)
  7. 268736Species Pig (Sus scrofa) [TaxId:9823] [56999] (16 PDB entries)
  8. 268764Domain d7ins.2: 7ins D:,C: [43976]

Details for d7ins.2

PDB Entry: 7ins (more details), 2 Å

PDB Description: structure of porcine insulin cocrystallized with clupeine z

SCOP Domain Sequences for d7ins.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g7ins.2 g.1.1.1 (D:,C:) Insulin {Pig (Sus scrofa)}
fvnqhlcgshlvealylvcgergffytpkaXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d7ins.2:

Click to download the PDB-style file with coordinates for d7ins.2.
(The format of our PDB-style files is described here.)

Timeline for d7ins.2: