Lineage for d6inse_ (6ins E:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 202291Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 202292Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 202293Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 202298Protein Insulin [56996] (3 species)
  7. 202449Species Pig (Sus scrofa) [TaxId:9823] [56999] (16 PDB entries)
  8. 202474Domain d6inse_: 6ins E: [43974]

Details for d6inse_

PDB Entry: 6ins (more details), 2 Å

PDB Description: x-ray analysis of the single chain b29-a1 peptide-linked insulin molecule. a completely inactive analogue

SCOP Domain Sequences for d6inse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6inse_ g.1.1.1 (E:) Insulin {Pig (Sus scrofa)}
fvnqhlcgshlvealylvcgergffytpkgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d6inse_:

Click to download the PDB-style file with coordinates for d6inse_.
(The format of our PDB-style files is described here.)

Timeline for d6inse_:

202474
d6inse_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d6insf_