SCOP 1.57: Domain d6inse_: 6ins E:

Lineage for d6inse_ (6ins E:)

1. Root: SCOP 1.57

2. Class g: Small proteins [56992] (56 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (4 proteins)

6. Protein Insulin [56996] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [56999] (15 PDB entries)

8. Domain d6inse_: 6ins E: [43974]

Details for d6inse_

PDB Entry: 6ins, 2 Å

PDB Description: x-ray analysis of the single chain b29-a1 peptide-linked insulin molecule. a completely inactive analogue

SCOP Domain Sequences for d6inse_:

Sequence; same for both SEQRES and ATOM records:

>d6inse_ g.1.1.1 (E:) Insulin {Pig (Sus scrofa)}
fvnqhlcgshlvealylvcgergffytpkgiveqcctsicslyqlenycn

Timeline for d6inse_:

• d6inse_ first appeared (with stable ids) in SCOP 1.55
  
• d6inse_ appears in SCOP 1.59
  
• d6inse_ appears in the current release, SCOPe 2.08