Lineage for d6insf_ (6ins F:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88228Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 88229Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 88230Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 88235Protein Insulin [56996] (3 species)
  7. 88378Species Pig (Sus scrofa) [TaxId:9823] [56999] (15 PDB entries)
  8. 88402Domain d6insf_: 6ins F: [43973]

Details for d6insf_

PDB Entry: 6ins (more details), 2 Å

PDB Description: x-ray analysis of the single chain b29-a1 peptide-linked insulin molecule. a completely inactive analogue

SCOP Domain Sequences for d6insf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6insf_ g.1.1.1 (F:) Insulin {Pig (Sus scrofa)}
fvnqhlcgshlvealylvcgergffytpkgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d6insf_:

Click to download the PDB-style file with coordinates for d6insf_.
(The format of our PDB-style files is described here.)

Timeline for d6insf_:

88402
d6insf_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d6inse_