Lineage for d1izb.2 (1izb D:,C:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2256769Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 2256770Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 2256771Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 2256776Protein Insulin [56996] (3 species)
  7. 2256942Species Pig (Sus scrofa) [TaxId:9823] [56999] (26 PDB entries)
  8. 2256974Domain d1izb.2: 1izb D:,C: [43972]
    complexed with zn; mutant

Details for d1izb.2

PDB Entry: 1izb (more details), 2 Å

PDB Description: role of b13 glu in insulin assembly: the hexamer structure of recombinant mutant (b13 glu-> gln) insulin
PDB Compounds: (C:) insulin, (D:) insulin

SCOPe Domain Sequences for d1izb.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1izb.2 g.1.1.1 (D:,C:) Insulin {Pig (Sus scrofa) [TaxId: 9823]}
fvnqhlcgshlvqalylvcgergffytpktXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1izb.2:

Click to download the PDB-style file with coordinates for d1izb.2.
(The format of our PDB-style files is described here.)

Timeline for d1izb.2: