Lineage for d1zeib_ (1zei B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029609Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 3029610Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 3029611Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 3029616Protein Insulin [56996] (3 species)
  7. 3029784Species Pig (Sus scrofa) [TaxId:9823] [56999] (26 PDB entries)
  8. 3029806Domain d1zeib_: 1zei B: [43964]
    cross-linked b28 asp single-chain design
    complexed with cl, crs, zn

Details for d1zeib_

PDB Entry: 1zei (more details), 1.9 Å

PDB Description: cross-linked b28 asp insulin
PDB Compounds: (B:) insulin

SCOPe Domain Sequences for d1zeib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zeib_ g.1.1.1 (B:) Insulin {Pig (Sus scrofa) [TaxId: 9823]}
fvnqhlcgshlvealylvcgergffytdkaakgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1zeib_:

Click to download the PDB-style file with coordinates for d1zeib_.
(The format of our PDB-style files is described here.)

Timeline for d1zeib_: