Lineage for d1zeia_ (1zei A:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88228Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 88229Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 88230Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 88235Protein Insulin [56996] (3 species)
  7. 88378Species Pig (Sus scrofa) [TaxId:9823] [56999] (15 PDB entries)
  8. 88389Domain d1zeia_: 1zei A: [43963]

Details for d1zeia_

PDB Entry: 1zei (more details), 1.9 Å

PDB Description: cross-linked b28 asp insulin

SCOP Domain Sequences for d1zeia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zeia_ g.1.1.1 (A:) Insulin {Pig (Sus scrofa)}
fvnqhlcgshlvealylvcgergffytdkaakgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d1zeia_:

Click to download the PDB-style file with coordinates for d1zeia_.
(The format of our PDB-style files is described here.)

Timeline for d1zeia_: