![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
![]() | Superfamily g.1.1: Insulin-like [56994] (1 family) ![]() |
![]() | Family g.1.1.1: Insulin-like [56995] (5 proteins) |
![]() | Protein Insulin [56996] (3 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [56999] (26 PDB entries) |
![]() | Domain d1zeia_: 1zei A: [43963] cross-linked b28 asp single-chain design complexed with cl, crs, zn |
PDB Entry: 1zei (more details), 1.9 Å
SCOPe Domain Sequences for d1zeia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zeia_ g.1.1.1 (A:) Insulin {Pig (Sus scrofa) [TaxId: 9823]} fvnqhlcgshlvealylvcgergffytdkaakgiveqcctsicslyqlenycn
Timeline for d1zeia_: