Lineage for d1zeia_ (1zei A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029609Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 3029610Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 3029611Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 3029616Protein Insulin [56996] (3 species)
  7. 3029784Species Pig (Sus scrofa) [TaxId:9823] [56999] (26 PDB entries)
  8. 3029805Domain d1zeia_: 1zei A: [43963]
    cross-linked b28 asp single-chain design
    complexed with cl, crs, zn

Details for d1zeia_

PDB Entry: 1zei (more details), 1.9 Å

PDB Description: cross-linked b28 asp insulin
PDB Compounds: (A:) insulin

SCOPe Domain Sequences for d1zeia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zeia_ g.1.1.1 (A:) Insulin {Pig (Sus scrofa) [TaxId: 9823]}
fvnqhlcgshlvealylvcgergffytdkaakgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1zeia_:

Click to download the PDB-style file with coordinates for d1zeia_.
(The format of our PDB-style files is described here.)

Timeline for d1zeia_: