Lineage for d2tci.2 (2tci D:,C:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39386Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 39387Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 39388Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 39393Protein Insulin [56996] (3 species)
  7. 39518Species Pig (Sus scrofa) [TaxId:9823] [56999] (15 PDB entries)
  8. 39536Domain d2tci.2: 2tci D:,C: [43962]

Details for d2tci.2

PDB Entry: 2tci (more details), 1.8 Å

PDB Description: x-ray crystallographic studies on hexameric insulins in the presence of helix-stabilizing agents, thiocyanate, methylparaben and phenol

SCOP Domain Sequences for d2tci.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g2tci.2 g.1.1.1 (D:,C:) Insulin {Pig (Sus scrofa)}
fvnqhlcgshlvealylvcgergffytpkaXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d2tci.2:

Click to download the PDB-style file with coordinates for d2tci.2.
(The format of our PDB-style files is described here.)

Timeline for d2tci.2: