SCOPe 2.08: Domain d2tci.2: 2tci D:,C:

Lineage for d2tci.2 (2tci D:,C:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)
   nearly all-alpha
   can be classified as disulfide-rich

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (5 proteins)

6. Protein Insulin [56996] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [56999] (26 PDB entries)

8. Domain d2tci.2: 2tci D:,C: [43962]
   complexed with scn, zn

Details for d2tci.2

PDB Entry: 2tci, 1.8 Å

PDB Description: x-ray crystallographic studies on hexameric insulins in the presence of helix-stabilizing agents, thiocyanate, methylparaben and phenol

PDB Compounds: (C:) thiocyanate insulin, (D:) thiocyanate insulin

SCOPe Domain Sequences for d2tci.2:

Sequence; same for both SEQRES and ATOM records:

>g2tci.2 g.1.1.1 (D:,C:) Insulin {Pig (Sus scrofa) [TaxId: 9823]}
fvnqhlcgshlvealylvcgergffytpkaXgiveqcctsicslyqlenycn

Timeline for d2tci.2:

• d2tci.2 first appeared (with stable ids) in SCOP 1.55
  
• d2tci.2 appears in SCOPe 2.07