Lineage for d1mhi.1 (1mhi B:,A:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88228Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 88229Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 88230Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 88235Protein Insulin [56996] (3 species)
  7. 88245Species Human (Homo sapiens) [TaxId:9606] [56998] (47 PDB entries)
  8. 88372Domain d1mhi.1: 1mhi B:,A: [43945]

Details for d1mhi.1

PDB Entry: 1mhi (more details)

PDB Description: three-dimensional solution structure of an insulin dimer. a study of the b9(asp) mutant of human insulin using nuclear magnetic resonance distance geometry and restrained molecular dynamics

SCOP Domain Sequences for d1mhi.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1mhi.1 g.1.1.1 (B:,A:) Insulin {Human (Homo sapiens)}
fvnqhlcgdhlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d1mhi.1:

Click to download the PDB-style file with coordinates for d1mhi.1.
(The format of our PDB-style files is described here.)

Timeline for d1mhi.1: