Lineage for d1aiy.3 (1aiy F:,E:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 142454Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 142455Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 142456Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 142461Protein Insulin [56996] (3 species)
  7. 142471Species Human (Homo sapiens) [TaxId:9606] [56998] (50 PDB entries)
  8. 142574Domain d1aiy.3: 1aiy F:,E: [43932]

Details for d1aiy.3

PDB Entry: 1aiy (more details)

PDB Description: r6 human insulin hexamer (symmetric), nmr, 10 structures

SCOP Domain Sequences for d1aiy.3:

Sequence; same for both SEQRES and ATOM records: (download)

>g1aiy.3 g.1.1.1 (F:,E:) Insulin {Human (Homo sapiens)}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d1aiy.3:

Click to download the PDB-style file with coordinates for d1aiy.3.
(The format of our PDB-style files is described here.)

Timeline for d1aiy.3: