Lineage for d1aiy.1 (1aiy B:,A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2256769Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 2256770Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 2256771Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 2256776Protein Insulin [56996] (3 species)
  7. 2256786Species Human (Homo sapiens) [TaxId:9606] [56998] (61 PDB entries)
    Uniprot P01308
  8. 2256903Domain d1aiy.1: 1aiy B:,A: [43930]
    complexed with iph, zn

Details for d1aiy.1

PDB Entry: 1aiy (more details)

PDB Description: r6 human insulin hexamer (symmetric), nmr, 10 structures
PDB Compounds: (A:) r6 insulin hexamer, (B:) r6 insulin hexamer

SCOPe Domain Sequences for d1aiy.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1aiy.1 g.1.1.1 (B:,A:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1aiy.1:

Click to download the PDB-style file with coordinates for d1aiy.1.
(The format of our PDB-style files is described here.)

Timeline for d1aiy.1: