Lineage for d1ai0.6 (1ai0 L:,K:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39386Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 39387Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 39388Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 39393Protein Insulin [56996] (3 species)
  7. 39403Species Human (Homo sapiens) [TaxId:9606] [56998] (42 PDB entries)
  8. 39490Domain d1ai0.6: 1ai0 L:,K: [43929]

Details for d1ai0.6

PDB Entry: 1ai0 (more details)

PDB Description: r6 human insulin hexamer (non-symmetric), nmr, 10 structures

SCOP Domain Sequences for d1ai0.6:

Sequence; same for both SEQRES and ATOM records: (download)

>g1ai0.6 g.1.1.1 (L:,K:) Insulin {Human (Homo sapiens)}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d1ai0.6:

Click to download the PDB-style file with coordinates for d1ai0.6.
(The format of our PDB-style files is described here.)

Timeline for d1ai0.6: