Lineage for d1ai0.5 (1ai0 J:,I:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581249Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 2581250Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 2581251Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 2581256Protein Insulin [56996] (3 species)
  7. 2581266Species Human (Homo sapiens) [TaxId:9606] [56998] (63 PDB entries)
    Uniprot P01308
  8. 2581384Domain d1ai0.5: 1ai0 J:,I: [43928]
    complexed with iph, zn

Details for d1ai0.5

PDB Entry: 1ai0 (more details)

PDB Description: r6 human insulin hexamer (non-symmetric), nmr, 10 structures
PDB Compounds: (I:) r6 insulin hexamer, (J:) r6 insulin hexamer

SCOPe Domain Sequences for d1ai0.5:

Sequence; same for both SEQRES and ATOM records: (download)

>g1ai0.5 g.1.1.1 (J:,I:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1ai0.5:

Click to download the PDB-style file with coordinates for d1ai0.5.
(The format of our PDB-style files is described here.)

Timeline for d1ai0.5: