Lineage for d1ai0.4 (1ai0 H:,G:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. Protein Insulin [56996] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [56998] (63 PDB entries)
    Uniprot P01308
  8. Domain d1ai0.4: 1ai0 H:,G: [43927]
    complexed with iph, zn

Details for d1ai0.4

PDB Entry: 1ai0 (more details)

PDB Description: r6 human insulin hexamer (non-symmetric), nmr, 10 structures
PDB Compounds: (G:) r6 insulin hexamer, (H:) r6 insulin hexamer

SCOPe Domain Sequences for d1ai0.4:

Sequence; same for both SEQRES and ATOM records: (download)

>g1ai0.4 g.1.1.1 (H:,G:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1ai0.4 are not available.

Timeline for d1ai0.4:

Domains from other chains:
(mouse over for more information)
d1ai0.1, d1ai0.1, d1ai0.1, d1ai0.1, d1ai0.2, d1ai0.2, d1ai0.2, d1ai0.2, d1ai0.3, d1ai0.3, d1ai0.3, d1ai0.3, d1ai0.5, d1ai0.5, d1ai0.5, d1ai0.5, d1ai0.6, d1ai0.6, d1ai0.6, d1ai0.6