Lineage for d1fu2.3 (1fu2 F:,E:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029609Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 3029610Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 3029611Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 3029616Protein Insulin [56996] (3 species)
  7. 3029626Species Human (Homo sapiens) [TaxId:9606] [56998] (63 PDB entries)
    Uniprot P01308
  8. 3029780Domain d1fu2.3: 1fu2 F:,E: [43908]
    complexed with cl, na, zn

Details for d1fu2.3

PDB Entry: 1fu2 (more details)

PDB Description: first protein structure determined from x-ray powder diffraction data
PDB Compounds: (E:) insulin, a chain, (F:) insulin, b chain

SCOPe Domain Sequences for d1fu2.3:

Sequence; same for both SEQRES and ATOM records: (download)

>g1fu2.3 g.1.1.1 (F:,E:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1fu2.3:

Click to download the PDB-style file with coordinates for d1fu2.3.
(The format of our PDB-style files is described here.)

Timeline for d1fu2.3: