Lineage for d1fu2.2 (1fu2 D:,C:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634416Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 2634417Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 2634418Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 2634423Protein Insulin [56996] (3 species)
  7. 2634433Species Human (Homo sapiens) [TaxId:9606] [56998] (63 PDB entries)
    Uniprot P01308
  8. 2634586Domain d1fu2.2: 1fu2 D:,C: [43907]
    complexed with cl, na, zn

Details for d1fu2.2

PDB Entry: 1fu2 (more details)

PDB Description: first protein structure determined from x-ray powder diffraction data
PDB Compounds: (C:) insulin, a chain, (D:) insulin, b chain

SCOPe Domain Sequences for d1fu2.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1fu2.2 g.1.1.1 (D:,C:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1fu2.2:

Click to download the PDB-style file with coordinates for d1fu2.2.
(The format of our PDB-style files is described here.)

Timeline for d1fu2.2: