Lineage for d4aiy.5 (4aiy J:,I:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634416Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 2634417Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 2634418Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 2634423Protein Insulin [56996] (3 species)
  7. 2634433Species Human (Homo sapiens) [TaxId:9606] [56998] (63 PDB entries)
    Uniprot P01308
  8. 2634541Domain d4aiy.5: 4aiy J:,I: [43904]
    complexed with iph

Details for d4aiy.5

PDB Entry: 4aiy (more details)

PDB Description: r6 human insulin hexamer (symmetric), nmr, 'green' substate, average structure
PDB Compounds: (I:) protein (insulin), (J:) protein (insulin)

SCOPe Domain Sequences for d4aiy.5:

Sequence; same for both SEQRES and ATOM records: (download)

>g4aiy.5 g.1.1.1 (J:,I:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d4aiy.5:

Click to download the PDB-style file with coordinates for d4aiy.5.
(The format of our PDB-style files is described here.)

Timeline for d4aiy.5: