Lineage for d5aiy.2 (5aiy D:,C:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 202291Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 202292Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 202293Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 202298Protein Insulin [56996] (3 species)
  7. 202308Species Human (Homo sapiens) [TaxId:9606] [56998] (53 PDB entries)
  8. 202389Domain d5aiy.2: 5aiy D:,C: [43895]

Details for d5aiy.2

PDB Entry: 5aiy (more details)

PDB Description: r6 human insulin hexamer (symmetric), nmr, 'red' substate, average structure

SCOP Domain Sequences for d5aiy.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g5aiy.2 g.1.1.1 (D:,C:) Insulin {Human (Homo sapiens)}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d5aiy.2:

Click to download the PDB-style file with coordinates for d5aiy.2.
(The format of our PDB-style files is described here.)

Timeline for d5aiy.2: