SCOP 1.61: Domain d5aiy.1: 5aiy B:,A:

Lineage for d5aiy.1 (5aiy B:,A:)

1. Root: SCOP 1.61

2. Class g: Small proteins [56992] (59 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (4 proteins)

6. Protein Insulin [56996] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56998] (53 PDB entries)

8. Domain d5aiy.1: 5aiy B:,A: [43894]

Details for d5aiy.1

PDB Entry: 5aiy

PDB Description: r6 human insulin hexamer (symmetric), nmr, 'red' substate, average structure

SCOP Domain Sequences for d5aiy.1:

Sequence; same for both SEQRES and ATOM records:

>g5aiy.1 g.1.1.1 (B:,A:) Insulin {Human (Homo sapiens)}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

Timeline for d5aiy.1:

• d5aiy.1 first appeared (with stable ids) in SCOP 1.55
  
• d5aiy.1 appears in SCOP 1.59
  
• d5aiy.1 appears in SCOP 1.63
  
• d5aiy.1 appears in the current release, SCOPe 2.08